PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43603.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 390aa    MW: 44069.1 Da    PI: 6.9609
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43603.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.94.8e-2775157286
    trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 W ++e++ Li +rr m+  ++++k++k+lWe++s+kmr++gf rsp++C++kw+nl k++kk k+++++  ++ s +++y++++e
  KFK43603.1  75 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISNKMRDKGFDRSPTMCTDKWRNLLKEFKKAKHHDRG--NGGSAKMSYYKEIE 157
                 ********************************************************************9..688889*****998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-465136IPR009057Homeodomain-like
PROSITE profilePS500908.03767131IPR017877Myb-like domain
SMARTSM007170.008471133IPR001005SANT/Myb domain
CDDcd122031.38E-2973138No hitNo description
PfamPF138376.9E-2074158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MFLSDNTNSS TTGRSNMIID VTTNNGGASG GTVDLRPHNH HNNLQPQQQQ ILLGESSGGE  60
DSHEVKAPKK RAETWVQDET RSLIMFRRGM DGLFNTSKSN KHLWEQISNK MRDKGFDRSP  120
TMCTDKWRNL LKEFKKAKHH DRGNGGSAKM SYYKEIEDIL RERSKKVNTQ YSKSPTTPPT  180
AKVDSFMQFT DKGFDDTSIS FGSVEANGRP ALNLETRLDH DGHPLAITAV DAVAANGVPP  240
WNWRETPGNG SDAQVFGGRV ITVKFGDYTR RIGVDGSSEA IKETIRSAFG LRTKRAFWLE  300
DEDQVVRCLD RDMPLGNYLL HVDDGLAIRV CHYDESNQLP VHTEEKIFYT EEDYRDFLAR  360
RGWTCLQVDG FRNIDSMDDL QPGAVYRGVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-5469155186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2283050.0AK228305.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-74-C23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307687.10.0hypothetical protein CARUB_v10009313mg
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A087HNA10.0A0A087HNA1_ARAAL; Uncharacterized protein
STRINGBra019721.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein